PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.0D160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 217aa    MW: 23704.1 Da    PI: 11.4611
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.0D160genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.36.4e-27252252
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                 prlrWtp+LH +F +av++LGG+e+AtPk +l+lm+v gL+++hvkSHLQ 
  Araip.0D160  2 PRLRWTPNLHLSFSHAVQRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQI 52
                 8*************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-23151IPR009057Homeodomain-like
PROSITE profilePS512949.3158IPR017930Myb domain
SuperFamilySSF466894.66E-11252IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-19252IPR006447Myb domain, plants
PfamPF002494.3E-6351IPR001005SANT/Myb domain
Gene3DG3DSA:1.25.10.101.6E-486147IPR011989Armadillo-like helical
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MPRLRWTPNL HLSFSHAVQR LGGQERATPK LVLQLMNVRG LSIAHVKSHL QILKGSLLML  60
SLHCSRLLIL SMRRIHEGAS AAPKGSVNTS ESSSLVAAGG LDSLPREDIS GKITPTLLKS  120
LESPELKVRM ESIEAVNKIL EEANKRIQAN GTGIPTYKAA LTLLMVFGVG PTVFGIMSNI  180
HKLVRKKNGS MLRAFIALAL IKFKQPWLWS SSSKSKG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.13e-25G2-like family protein